PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009804619.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 590aa    MW: 64703.7 Da    PI: 7.3962
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009804619.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.4e-11428487564
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                     kr++r   NR +A rs +RK  +i+eLe kv++L++e ++L  +l  l+  +a l+s+++
  XP_009804619.1 428 KRAKRILANRQSAARSKERKMRYIAELEHKVQTLQTEATTLSAQLTLLQRDSAGLTSQNH 487
                     9******************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-19424488IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.795426489IPR004827Basic-leucine zipper domain
PfamPF001704.2E-10428487IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.84E-11428484No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-11428485No hitNo description
CDDcd147036.34E-24429480No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MGGDNEEGNS DMVQRLQSSF GTSSSSLPKK HQSLLSMNQL DIPQLTSTSQ FRGQMRQFSP  60
NFSVENSTNK RVGIPPSHPQ MPPISPYSQI PVTRPVNQQM GMQNFTSPGP PHSRSLSQPS  120
FFSLDSLPPL SPSPYRESSS TSMSDPISAD VSMGDQDGNS HSLLPPSPFT RCNSSRAGES  180
LPPRKAHRRS NSDIPFGFSA MMQSSPPLVP LRSPGSLERS VPSREKPIQL VKREAMWDKG  240
NDSNAEGMGE RKSEGEVVDD LFSAYMNLDN IDALNSSGTD DKLGNENRED LDSRASGTKT  300
NGGDSSDNEA TSSVNDSGSS MQRLGISSSV EKKEGIKRSA VGDIAPTTRH YRSVSMDSFM  360
GKLNFVDDSP KLPPSPGPRP GQLSPTSSLD ANSNSFSLEF GNGEFSGAEL KKIMANEKLA  420
EIALTDPKRA KRILANRQSA ARSKERKMRY IAELEHKVQT LQTEATTLSA QLTLLQRDSA  480
GLTSQNHELK FRLQAMEQQA QLRDALNEAL TAEVQRLKLA TTEISADPAK FQQLSLNPQM  540
FQLQQQQSTQ LNMHQLQQQQ QQQQQQQSSQ PPQHAQQQLN SSTPSKNESK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009804619.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_009804620.10.0PREDICTED: probable transcription factor PosF21
RefseqXP_016442558.10.0PREDICTED: probable transcription factor PosF21
TrEMBLK4B3R10.0K4B3R1_SOLLC; Uncharacterized protein
STRINGSolyc01g110480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12652478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-133bZIP family protein